Shopping Cart
- Remove All
- Your shopping cart is currently empty
Galanin (1-30), human acetate (Galanin ) is a 30-amino acid neuropeptide. Galanin (1-30), human acetate acts as an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $221 | In Stock | |
5 mg | $549 | In Stock | |
10 mg | $793 | In Stock | |
25 mg | $1,220 | In Stock | |
50 mg | $1,630 | In Stock | |
100 mg | $2,190 | In Stock |
Description | Galanin (1-30), human acetate (Galanin ) is a 30-amino acid neuropeptide. Galanin (1-30), human acetate acts as an agonist of GalR1 and GalR2 receptors, with Kis of both 1 nM. |
Alias | Galanin (1-30), human acetate(119418-04-1 Free base) |
Molecular Weight | 3217.51 |
Formula | C141H214N42O45 |
Smiles | C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N2CCC[C@H]2C(=O)N[C@@H](CC3=CNC=N3)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC4=CNC=N4)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC5=CC=CC=C5)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CC6=CNC7=CC=CC=C76)NC(=O)CN)O.CC(=O)O |
Sequence | H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH.CH3CO2H |
Sequence Short | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.