Your shopping cart is currently empty

Adrenomedullin (1-50), rat, is a 50 amino acid peptide that induces selective arterial vasodilation via activation of the CGRP1 receptor. This peptide hormone is expressed in rat adrenal glands, lung, kidney, heart, and spleen, as well as in the duodenum and submandibular glands.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $288 | Inquiry | Inquiry | |
| 5 mg | $998 | Inquiry | Inquiry |
| Description | Adrenomedullin (1-50), rat, is a 50 amino acid peptide that induces selective arterial vasodilation via activation of the CGRP1 receptor. This peptide hormone is expressed in rat adrenal glands, lung, kidney, heart, and spleen, as well as in the duodenum and submandibular glands. |
| Molecular Weight | 5729.5 |
| Formula | C248H381N77O75S5 |
| Cas No. | 159964-38-2 |
| Smiles | [C@@H](CC1=CC=CC=C1)(NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CC=C(O)C=C2)N)=O)CCCNC(=N)N)=O)CCC(N)=O)=O)CO)=O)CCSC)=O)CC(N)=O)=O)CC(N)=O)=O)C(N[C@H](C(NCC(N[C@H](C(N[C@@H](CCCNC(=N)N)C(O)=O)=O)CC(C)C)=O)=O)C)=O |
| Relative Density. | 1.51 g/cm3 (Predicted) |
| Sequence | Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19) |
| Sequence Short | YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY (Disulfide bridge: Cys14-Cys19) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.