Shopping Cart
- Remove All
- Your shopping cart is currently empty
Adrenomedullin (1-50), rat, is a 50 amino acid peptide that induces selective arterial vasodilation via activation of the CGRP1 receptor. This peptide hormone is expressed in rat adrenal glands, lung, kidney, heart, and spleen, as well as in the duodenum and submandibular glands.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $288 | Backorder | |
5 mg | $998 | Backorder |
Description | Adrenomedullin (1-50), rat, is a 50 amino acid peptide that induces selective arterial vasodilation via activation of the CGRP1 receptor. This peptide hormone is expressed in rat adrenal glands, lung, kidney, heart, and spleen, as well as in the duodenum and submandibular glands. |
Molecular Weight | 5729.5 |
Formula | C248H381N77O75S5 |
Cas No. | 159964-38-2 |
Relative Density. | 1.51 g/cm3 (Predicted) |
Sequence | Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19) |
Sequence Short | YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: Cys14-Cys19) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.