Shopping Cart
- Remove All
Your shopping cart is currently empty
Adrenomedullin 11-50 rat is a peptide fragment of adrenomedullin that possesses systemic vasodilator activity at the level of calcitonin gene-related peptide-1 (CGRP1) receptor activation. Adrenomedullin and its peptide may be used in bone growth studies.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 100 mg | Inquiry | Backorder | |
| 500 mg | Inquiry | Backorder |
| Description | Adrenomedullin 11-50 rat is a peptide fragment of adrenomedullin that possesses systemic vasodilator activity at the level of calcitonin gene-related peptide-1 (CGRP1) receptor activation. Adrenomedullin and its peptide may be used in bone growth studies. |
| Molecular Weight | 4521.17 |
| Formula | C194H304N58O59S4 |
| Cas No. | 163648-32-6 |
| Relative Density. | no data available |
| Sequence | Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9) |
| Sequence Short | STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2(Disulfide bridge: Cys4-Cys9) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.