Shopping Cart
- Remove All
Your shopping cart is currently empty
ω-Hexatoxin-Hv1a, a neurotoxin extracted from the venom of the spider Hadronyche versuta, inhibits voltage-gated calcium channels [1] [2].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | ω-Hexatoxin-Hv1a, a neurotoxin extracted from the venom of the spider Hadronyche versuta, inhibits voltage-gated calcium channels [1] [2]. |
| Synonyms | ω-Atracotoxin-HV1, ω-ACTX-Hv1 |
| Molecular Weight | 4049.38 |
| Formula | C162H247N49O61S6 |
| Cas No. | 193981-10-1 |
| Sequence | Ser-Pro-Thr-Cys-Ile-Pro-Ser-Gly-Gln-Pro-Cys-Pro-Tyr-Asn-Glu-Asn-Cys-Cys-Ser-Gln-Ser-Cys-Thr-Phe-Lys-Glu-Asn-Glu-Asn-Gly-Asn-Thr-Val-Lys-Arg-Cys-Asp (Disulfide bridge:Cys4-Cys18; Cys11-Cys22; Cys17-Cys36) |
| Sequence Short | SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD (Disulfide bridge:Cys4-Cys18; Cys11-Cys22; Cys17-Cys36) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.