Your shopping cart is currently empty

TLQP-62 (mouse, rat) is a secreted C-terminal peptide derived from the protein VGF. It activates the BDNF-TrkB signaling pathway, inducing acute and transient phosphorylation of TrkB receptors and downstream phosphorylation of CREB(Ser133). TLQP-62 effectively enhances long-term fear memory formation in wild-type mice and can reverse memory deficits in VGF heterozygous knockout mice. This compound is useful for researching memory-related neurological diseases, such as Alzheimer's disease and frontotemporal dementia.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | TLQP-62 (mouse, rat) is a secreted C-terminal peptide derived from the protein VGF. It activates the BDNF-TrkB signaling pathway, inducing acute and transient phosphorylation of TrkB receptors and downstream phosphorylation of CREB(Ser133). TLQP-62 effectively enhances long-term fear memory formation in wild-type mice and can reverse memory deficits in VGF heterozygous knockout mice. This compound is useful for researching memory-related neurological diseases, such as Alzheimer's disease and frontotemporal dementia. |
| In vitro | TLQP-62 (10 μM, 10 min) rapidly and transiently activates TrkB receptor phosphorylation. At a concentration of 10 μM for 30 minutes, TLQP-62 induces CREB phosphorylation at Ser133 and enhances cofilin phosphorylation in mouse hippocampal slices. |
| In vivo | TLQP-62, when administered bilaterally into the hippocampus at a dose of 0.3 μg/side immediately after training, enhances long-term fear memory formation in mice. Additionally, a single intraperitoneal injection of TLQP-62 at 5 mg/kg, given right after training, reverses memory deficits in male N2F1 VGF heterozygous knockout mice. |
| Sequence | Thr-Leu-Gln-Pro-Pro-Ala-Ser-Ser-Arg-Arg-Arg-His-Phe-His-His-Ala-Leu-Pro-Pro-Ala-Arg-His-His-Pro-Asp-Leu-Glu-Ala-Gln-Ala-Arg-Arg-Ala-Gln-Glu-Glu-Ala-Asp-Ala-Glu-Glu-Arg-Arg-Leu-Gln-Glu-Gln-Glu-Glu-Leu-Glu-Asn-Tyr-Ile-Glu-His-Val-Leu-Leu-His-Arg-Pro |
| Sequence Short | TLQPPASSRRRHFHHALPPARHHPDLEAQARRAQEEADAEERRLQEQEELENYIEHVLLHRP |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.