Shopping Cart
- Remove All
- Your shopping cart is currently empty
TAT-HA2 Fusion Peptide, a peptide-based delivery agent, synergizes the pH-sensitive HA2 fusion peptide from Influenza with the cell-penetrating peptide TAT from HIV. This compound facilitates the cellular uptake of macromolecules through the TAT component and triggers their release into cells by exploiting the acidifying endosomal lumen to induce membrane leakage via the HA2 component [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | TAT-HA2 Fusion Peptide, a peptide-based delivery agent, synergizes the pH-sensitive HA2 fusion peptide from Influenza with the cell-penetrating peptide TAT from HIV. This compound facilitates the cellular uptake of macromolecules through the TAT component and triggers their release into cells by exploiting the acidifying endosomal lumen to induce membrane leakage via the HA2 component [1]. |
Molecular Weight | 3432.92 |
Formula | C149H243N53O39S |
Cas No. | 923954-79-4 |
Sequence | Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly |
Sequence Short | RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.