Shopping Cart
- Remove All
- Your shopping cart is currently empty
Tat-beclin 1 acetate is a potent inducer of autophagy and interacts with the negative regulator of autophagy, GAPR-1. Tat-beclin 1 acetate decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1).
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $73 | In Stock | |
5 mg | $148 | In Stock | |
10 mg | $251 | In Stock | |
25 mg | $418 | In Stock | |
50 mg | $595 | In Stock | |
100 mg | $798 | In Stock | |
500 mg | $1,600 | In Stock |
Description | Tat-beclin 1 acetate is a potent inducer of autophagy and interacts with the negative regulator of autophagy, GAPR-1. Tat-beclin 1 acetate decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1). |
In vitro | Tat-beclin 1 acetate (10 μM; 2-4 hours post-infection) decreases the intracellular survival of L. monocytogenes in primary murine bone-marrow-derived macrophages (BMDMs)[1]. Tat-beclin 1 acetate (10, 30, 50 μM; 24 hours) induces autophagy and results in a dose-dependent decrease in amounts of p62, a selective autophagy substrate, and a dose-dependent conversion of the non-lipidated form of LC3, LC3-I, to the lipidated, autophagosome-associated form of LC3, LC3-II, in multiple cell lines and primary murine embryonic fibroblasts (MEFs)[1]. |
In vivo | Tat-beclin 1 acetate reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV). Tat-beclin 1 acetate (15 mg/kg; i.p.) induces autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice[1]. |
Alias | Tat-beclin 1 acetate(1423821-88-8 free base) |
Relative Density. | no data available |
Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr |
Sequence Short | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | DMSO: 45 mg/mL, Sonication is recommended. ![]() |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.