Your shopping cart is currently empty

Tat-beclin 1, a peptide derived from the autophagy protein beclin 1, is a powerful inducer of autophagy. It interacts with GAPR-1 (GLIPR2), a negative regulator of autophagy. Tat-beclin 1 effectively reduces polyglutamine expansion protein aggregates and inhibits various pathogens, such as HIV-1, in laboratory experiments. Additionally, it decreases mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV).

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 50 mg | $982 | Inquiry | Inquiry |
| Description | Tat-beclin 1, a peptide derived from the autophagy protein beclin 1, is a powerful inducer of autophagy. It interacts with GAPR-1 (GLIPR2), a negative regulator of autophagy. Tat-beclin 1 effectively reduces polyglutamine expansion protein aggregates and inhibits various pathogens, such as HIV-1, in laboratory experiments. Additionally, it decreases mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV). |
| In vitro | Tat-beclin 1, at concentrations of 10, 30, and 50 μM administered for 24 hours, promotes autophagy, leading to a dose-dependent reduction in p62 levels—a selective autophagy marker—and facilitates the transformation of LC3-I into its autophagosome-associated, lipidated counterpart, LC3-II, across various cell lines and in primary murine embryonic fibroblasts (MEFs). Additionally, at a concentration of 10 μM and applied 2-4 hours after infection, Tat-beclin 1 significantly reduces the intracellular survival rate of L. monocytogenes within primary murine bone-marrow-derived macrophages (BMDMs). |
| In vivo | Tat-beclin 1, administered intraperitoneally at a dosage of 15 mg/kg daily starting one day after infection and continuing for 20 days, induces autophagy in the peripheral tissues of adult mice and in the central nervous system of neonatal mice (6-week-old GFP-LC3 mice)[1]. |
| Cas No. | 1423821-88-8 |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr |
| Sequence Short | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.