Shopping Cart
- Remove All
- Your shopping cart is currently empty
Tat-beclin 1, a peptide derived from the autophagy protein beclin 1, is a powerful inducer of autophagy. It interacts with GAPR-1 (GLIPR2), a negative regulator of autophagy. Tat-beclin 1 effectively reduces polyglutamine expansion protein aggregates and inhibits various pathogens, such as HIV-1, in laboratory experiments. Additionally, it decreases mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV).
Pack Size | Price | Availability | Quantity |
---|---|---|---|
50 mg | $982 | Backorder |
Description | Tat-beclin 1, a peptide derived from the autophagy protein beclin 1, is a powerful inducer of autophagy. It interacts with GAPR-1 (GLIPR2), a negative regulator of autophagy. Tat-beclin 1 effectively reduces polyglutamine expansion protein aggregates and inhibits various pathogens, such as HIV-1, in laboratory experiments. Additionally, it decreases mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV). |
In vitro | Tat-beclin 1, at concentrations of 10, 30, and 50 μM administered for 24 hours, promotes autophagy, leading to a dose-dependent reduction in p62 levels—a selective autophagy marker—and facilitates the transformation of LC3-I into its autophagosome-associated, lipidated counterpart, LC3-II, across various cell lines and in primary murine embryonic fibroblasts (MEFs). Additionally, at a concentration of 10 μM and applied 2-4 hours after infection, Tat-beclin 1 significantly reduces the intracellular survival rate of L. monocytogenes within primary murine bone-marrow-derived macrophages (BMDMs). |
In vivo | Tat-beclin 1, administered intraperitoneally at a dosage of 15 mg/kg daily starting one day after infection and continuing for 20 days, induces autophagy in the peripheral tissues of adult mice and in the central nervous system of neonatal mice (6-week-old GFP-LC3 mice)[1]. |
Cas No. | 1423821-88-8 |
Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr |
Sequence Short | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.