Shopping Cart
- Remove All
Your shopping cart is currently empty
PHM-27 (human) acetate is the endogenous peptide product of prepro-VIP (human), an agonist of the calcitonin receptor (EC 50 = 11 nM). Transgenic mice overexpressing PHM-27 (human) acetate in pancreatic β-islets exhibited enhanced glucose-induced insulin secretion.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 1 mg | $60 | In Stock | |
| 5 mg | $156 | In Stock | |
| 10 mg | $253 | In Stock | |
| 25 mg | $430 | In Stock | |
| 50 mg | $645 | In Stock |
| Description | PHM-27 (human) acetate is the endogenous peptide product of prepro-VIP (human), an agonist of the calcitonin receptor (EC 50 = 11 nM). Transgenic mice overexpressing PHM-27 (human) acetate in pancreatic β-islets exhibited enhanced glucose-induced insulin secretion. |
| Synonyms | PHM-27, human, acetate, PHM-27 (human) acetate(87403-73-4 Free base) |
| Molecular Weight | 3099.44 |
| Formula | C137H215F3N34O42S |
| Smiles | OC(C=C1)=CC=C1C[C@@H](C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CO)C(N[C@@H](CC(C)C)C(N[C@H](C(N)=O)CCSC)=O)=O)=O)=O)=O)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@H](C)NC([C@H](CO)NC([C@H](CC(C)C)NC([C@H](CCC(N)=O)NC(CNC([C@H](CC(C)C)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC([C@H](CO)NC([C@@H](NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H]([C@H](O)C)NC([C@@H](NC([C@H](C(C)C)NC(CNC([C@H](CC(O)=O)NC([C@H](C)NC([C@@H](N)CC2=CN=CN2)=O)=O)=O)=O)=O)CC3=CC=CC=C3)=O)=O)=O)=O)CC4=CC=CC=C4)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O.O=C(C(F)(F)F)O |
| Relative Density. | no data available |
| Sequence | {His}{Ala}{Asp}{Gly}{Val}{Phe}{Thr}{Ser}{Asp}{Phe}{Ser}{Lys}{Leu}{Leu}{Gly}{Gln}{Leu}{Ser}{Ala}{Lys}{Lys}{Tyr}{Leu}{Glu}{Ser}{Leu}{Met}-NH2 |
| Sequence Short | HADGVFTSDFSKLLGQLSAKKYLESLM-NH2 |
| Storage | keep away from moisture | store at -20°C | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.