PHM-27 (human)

Name: PHM-27 (human)
Brand: TargetMol
SKU: TP1954
Rating: 4.5 (1 reviews)

😃Good

Catalog No. TP1954Cas No. 87403-73-4

Endogenous peptide product of human prepro-VIP and analog of porcine PHI-27; potent agonist for the human calcitonin receptor (EC50 = 11 nM). Transgenic mice expressing the human VIP/PHM 27 gene in pancreatic β-islets display enhanced glucose-induced insulin secretion.

PHM-27 (human)

😃Good

Catalog No. TP1954Cas No. 87403-73-4

Pack Size	Price	USA Warehouse	Global Warehouse	Quantity
1 mg	$231	Inquiry	Inquiry

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Resource Download

Product Introduction

Bioactivity

Description

Chemical Properties

Molecular Weight	2985.44
Formula	C₁₃₅H₂₁₄N₃₄O₄₀S
Cas No.	87403-73-4
Smiles	[C@@H](CC1=CC=C(O)C=C1)(NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CC=CC=C2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC3=CC=CC=C3)NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H](CC4=CN=CN4)N)=O)C)=O)CC(O)=O)=O)=O)C(C)C)=O)=O)[C@@H](C)O)=O)CO)=O)CC(O)=O)=O)=O)CO)=O)CCCCN)=O)CC(C)C)=O)CC(C)C)=O)=O)CCC(N)=O)=O)CC(C)C)=O)CO)=O)C)=O)CCCCN)=O)CCCCN)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCSC)C(N)=O)=O)CC(C)C)=O)CO)=O)CCC(O)=O)=O)CC(C)C)=O
Relative Density.	1.303 g/cm3 (Predicted)
Sequence	{His}{Ala}{Asp}{Gly}{Val}{Phe}{Thr}{Ser}{Asp}{Phe}{Ser}{Lys}{Leu}{Leu}{Gly}{Gln}{Leu}{Ser}{Ala}{Lys}{Lys}{Tyr}{Leu}{Glu}{Ser}{Leu}{Met}-NH2
Sequence Short	HADGVFTSDFSKLLGQLSAKKYLESLM-NH2

Storage & Solubility Information

Storage	keep away from moisture \| Powder: -20°C for 3 years \| In solvent: -80°C for 1 year \| Shipping with blue ice/Shipping at ambient temperature.
Solubility Information	5% acetonitrile / water: 1 mg/mL (0.33 mM), Sonication is recommended.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the mother liquor preparation method and in vivo formula preparation method:

For example, your dosage is 10 mg/kg Each animal weighs 20 g, and the dosage volume is 100 μL . TargetMol | Animal experiments

A total of 10 animals were administered, and the formula you used is 5% TargetMol | reagent

DMSO+30% PEG300+5% Tween 80+60% Saline /PBS/ddH₂O. So your working solution concentration is 2 mg/mL。

Mother liquor preparation method: 2 mg of drug dissolved in 50 μL DMSO TargetMol | reagent

(mother liquor concentration of 40 mg/mL), if you need to configure a concentration that exceeds the solubility of the product, please contact us first.

Preparation method for in vivo formula: Take 50 μL DMSO TargetMol | reagent

main solution, add 300 μLPEG300 TargetMol | reagent

mix well and clarify, then add 50 more μL Tween 80, mix well and clarify, then add 600 more μLSaline /PBS/ddH₂O TargetMol | reagent

mix well and clarify

For Reference Only. Please develop an appropriate dissolution method based on your laboratory animals and route of administration.

All types of co-solvents required for the protocol, such asDMSO, PEG300/ PEG400, Tween 80, SBE-β-CD, corn oil are available for purchase on the TargetMol website with a simple click.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc