Shopping Cart
- Remove All
- Your shopping cart is currently empty
Peptide YY (PYY) (3-36), porcine TFA, acts as a gut hormone and Y2 receptor agonist, effectively reducing appetite [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Peptide YY (PYY) (3-36), porcine TFA, acts as a gut hormone and Y2 receptor agonist, effectively reducing appetite [1]. |
Molecular Weight | 4094.44 |
Formula | C176H272N52O54.C2HF3O2 |
Sequence | Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr |
Sequence Short | AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.