Shopping Cart
Remove All
Your shopping cart is currently empty
Peptide YY (PYY) (3-36), human acetate (126339-09-1 Free base) is a NPY (neuropeptide Y) Y2 receptor agonist that suppresses intestinal fluid secretion and slows colonic transit to inhibit diarrhea in mice.

| Description | Peptide YY (PYY) (3-36), human acetate (126339-09-1 Free base) is a NPY (neuropeptide Y) Y2 receptor agonist that suppresses intestinal fluid secretion and slows colonic transit to inhibit diarrhea in mice. |
| Synonyms | Peptide YY (PYY) (3-36), human acetate(126339-09-1 Free base) |
| Color | White |
| Appearance | Solid |
| Sequence | Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Short | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.