Shopping Cart
Remove All
Your shopping cart is currently empty
Parathyroid Hormone (1-34), bovine, a parathyroid hormone (PTH) receptor agonist from the parathyroid hormone family, is used to study osteoporosis and hypoparathyroidism.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $81 | - | In Stock | |
| 5 mg | $197 | - | In Stock | |
| 10 mg | $297 | - | In Stock | |
| 25 mg | $492 | - | In Stock | |
| 50 mg | Preferential | - | In Stock |
| Description | Parathyroid Hormone (1-34), bovine, a parathyroid hormone (PTH) receptor agonist from the parathyroid hormone family, is used to study osteoporosis and hypoparathyroidism. |
| In vitro | In MC3T3-E1 cells, parathyroid hormone ( 1-34 ), bovine ( 0.1-100 ng/m L; 2 ~ 20 days ) decreased osteoblast proliferation in a concentration-dependent manner[1]. |
| Molecular Weight | 4104.39 |
| Formula | C183H288N54O50S2 |
| Cas No. | 12583-68-5 |
| Relative Density. | no data available |
| Sequence | H-Gly-Val-Ser-Glu-Ile-Gln-Gly-Met-His-Asn-Leu-Gly-Lys-His-Leu-Gly-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Sequence Short | GVSEIQGMHNLGKHLGSMERVEWLRKKLQDVHNF |
| Storage | store under nitrogen,keep away from direct sunlight,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||
| Solubility Information | H2O: H2O: 30 mg/mL (7.30 mM), Sonication is recommended. | |||||||||||||||
Solution Preparation Table | ||||||||||||||||
H2O
| ||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.