Shopping Cart
- Remove All
- Your shopping cart is currently empty
Parathyroid Hormone (1-34), bovine, a parathyroid hormone (PTH) receptor agonist from the parathyroid hormone family, is used to study osteoporosis and hypoparathyroidism.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $89 | In Stock | |
5 mg | $197 | In Stock | |
10 mg | $297 | In Stock | |
25 mg | $492 | In Stock | |
50 mg | $717 | In Stock |
Description | Parathyroid Hormone (1-34), bovine, a parathyroid hormone (PTH) receptor agonist from the parathyroid hormone family, is used to study osteoporosis and hypoparathyroidism. |
In vitro | In MC3T3-E1 cells, parathyroid hormone ( 1-34 ), bovine ( 0.1-100 ng/m L; 2 ~ 20 days ) decreased osteoblast proliferation in a concentration-dependent manner[1]. |
Molecular Weight | 4104.39 |
Formula | C183H288N54O50S2 |
Cas No. | 12583-68-5 |
Relative Density. | no data available |
Sequence | H-Gly-Val-Ser-Glu-Ile-Gln-Gly-Met-His-Asn-Leu-Gly-Lys-His-Leu-Gly-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
Sequence Short | GVSEIQGMHNLGKHLGSMERVEWLRKKLQDVHNF |
Storage | store under nitrogen,keep away from direct sunlight,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | |||||||||||||||
Solubility Information | H2O: H2O: 30 mg/mL (7.30 mM), Sonication is recommended. | |||||||||||||||
Solution Preparation Table | ||||||||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.