Shopping Cart
- Remove All
- Your shopping cart is currently empty
Eneboparatide (AZP-3601), a 36 amino-acid parathyroid hormone (PTH) analog and an agonist of the parathyroid hormone receptor 1 (PTHR1), elevates albumin-adjusted serum calcium levels while maintaining them within the normal laboratory range [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
10 mg | Inquiry | Inquiry | |
50 mg | Inquiry | Inquiry |
Description | Eneboparatide (AZP-3601), a 36 amino-acid parathyroid hormone (PTH) analog and an agonist of the parathyroid hormone receptor 1 (PTHR1), elevates albumin-adjusted serum calcium levels while maintaining them within the normal laboratory range [1]. |
Synonyms | AZP-3601 |
Formula | C191H312N60O49S |
Cas No. | 1349298-00-5 |
Sequence | Ala-Val-Ala-Glu-Ile-Gln-Leu-Met-His-Gln-Arg-Ala-Lys-Trp-Ile-Gln-Asp-Ala-Arg-Arg-Arg-Ala-Phe-Leu-His-Lys-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile |
Sequence Short | AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI |
Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.