Your shopping cart is currently empty

P9R is an antiviral peptide with broad-spectrum activity against coronaviruses (SARS-CoV-2, MERS-CoV, and SARS-CoV), influenza A H1N1 virus (A(H1N1)pdm09), influenza A H7N9 virus (A(H7N9) virus), and rhinovirus. It binds directly to viruses and inhibits virus-host endosomal acidification. P9R significantly protects mice from infection by influenza A H1N1 virus (A(H1N1)pdm09) without leading to resistant viruses. P9R is applicable in studying pH-dependent respiratory viruses.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | P9R is an antiviral peptide with broad-spectrum activity against coronaviruses (SARS-CoV-2, MERS-CoV, and SARS-CoV), influenza A H1N1 virus (A(H1N1)pdm09), influenza A H7N9 virus (A(H7N9) virus), and rhinovirus. It binds directly to viruses and inhibits virus-host endosomal acidification. P9R significantly protects mice from infection by influenza A H1N1 virus (A(H1N1)pdm09) without leading to resistant viruses. P9R is applicable in studying pH-dependent respiratory viruses. |
| Molecular Weight | 3412.03 |
| Formula | C144H232N52O35S5 |
| Cas No. | 2484874-12-4 |
| Smiles | C([C@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@H](CC(N)=O)N)=O)=O)C)=O)[C@H](CC)C)=O)CS)=O)C(NCC(=O)N1[C@H](C(N[C@H](C(=O)N2[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC3=CC=CC=C3)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@@H](CC4=CC=CC=C4)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCCNC(=N)N)C(O)=O)=O)[C@H](CC)C)=O)CCCNC(=N)N)=O)CS)=O)CS)=O)CCCNC(=N)N)=O)C(C)C)=O)CCCNC(=N)N)=O)=O)CCCNC(=N)N)=O)=O)CS)=O)CC(N)=O)=O)=O)[C@H](CC)C)=O)CCC(N)=O)=O)CCCNC(=N)N)=O)=O)C)=O)[C@@H](C)O)=O)CCC2)CS)=O)CCC1)=O)C=5C=6C(NC5)=CC=CC6 |
| Sequence | Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg |
| Sequence Short | NGAICWGPCPTAFRQIGNCGRFRVRCCRIR |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.