Shopping Cart
Remove All
Your shopping cart is currently empty
Obtustatin triacetate, a desintegrin derived from the venom of Vipera lebetina obtusa, is a selective α1β1 integrin and in vivo angiogenesis inhibitor that inhibits angiogenesis, and can be used to study cell adhesion and cardiovascular disease.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Obtustatin triacetate, a desintegrin derived from the venom of Vipera lebetina obtusa, is a selective α1β1 integrin and in vivo angiogenesis inhibitor that inhibits angiogenesis, and can be used to study cell adhesion and cardiovascular disease. |
| Molecular Weight | 4573.21 |
| Formula | C184H284N52O57S8.3C2H4O2 |
| Sequence | Cys-Thr-Thr-Gly-Pro-Cys-Cys-Arg-Gln-Cys-Lys-Leu-Lys-Pro-Ala-Gly-Thr-Thr-Cys-Trp-Lys-Thr-Ser-Leu-Thr-Ser-His-Tyr-Cys-Thr-Gly-Lys-Ser-Cys-Asp-Cys-Pro-Leu-Tyr-Pro-Gly (Disulfide bridge: Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, Cys19-Cys36) |
| Sequence Short | CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG (Disulfide bridge: Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, Cys19-Cys36) |
| Storage | store at low temperature | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | DMSO: 80 mg/mL (17.49 mM), Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO
| |||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.