Your shopping cart is currently empty

NNC0165-1273 is a peptide YY (PYY3-36) analogue acting as an intestinal hormone. It shows significantly higher affinity for the Y2 receptor compared to the Y1, Y4, and Y5 receptors. NNC0165-1273 effectively induces anorexia and decreases food intake prompted by nocturnal and ghrelin stimulation through increased satiety. It also inhibits the expression of cFos in NPY/AgRP neurons induced by ghrelin. NNC0165-1273 is applicable in anti-obesity therapy research.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | NNC0165-1273 is a peptide YY (PYY3-36) analogue acting as an intestinal hormone. It shows significantly higher affinity for the Y2 receptor compared to the Y1, Y4, and Y5 receptors. NNC0165-1273 effectively induces anorexia and decreases food intake prompted by nocturnal and ghrelin stimulation through increased satiety. It also inhibits the expression of cFos in NPY/AgRP neurons induced by ghrelin. NNC0165-1273 is applicable in anti-obesity therapy research. |
| Sequence | Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Trp-Val-Thr-Arg-Gln-{β-homoArg}-Phe-NH2 |
| Sequence Short | IKPEAPGEDASPEELNRYYASLRHYLNWVTRQ-{β-homoArg}-Y |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.