Shopping Cart
- Remove All
- Your shopping cart is currently empty
Nisotirotide (LY-3457263), a PYY analog agonist, has been investigated for its therapeutic potential in type 2 diabetes and obesity [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Nisotirotide (LY-3457263), a PYY analog agonist, has been investigated for its therapeutic potential in type 2 diabetes and obesity [1]. |
Alias | LY-3457263 |
Cas No. | 2663844-45-7 |
Sequence | Chain1:Pro-Lys-Pro-Glu-Lys-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Trp-Gln-Arg-Tyr-Tyr-Ala-Glu-Leu-Arg-His-Tyr-Leu-Asn-Trp-Leu-Thr-Arg-Gln-Arg-Tyr-NH2; Chain2:Ggu-Ggu-Oaa (Amide bridge:Chain1 Lys5-Chain2 Oaa3) |
Sequence Short | Chain1:PKPEKPGEDASPEEWQRYYAELRHYLNWLTRQRY-NH2; Chain2:Ggu-Ggu-Oaa (Amide bridge:Chain1 Lys5-Chain2 Oaa3) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.