Shopping Cart
- Remove All
- Your shopping cart is currently empty
Neuropeptide Y (29-64), amide, human acetate is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $100 | In Stock | |
5 mg | $248 | In Stock | |
10 mg | $368 | In Stock | |
25 mg | $587 | In Stock | |
50 mg | $792 | In Stock | |
100 mg | $1,060 | In Stock | |
200 mg | $1,430 | In Stock |
Description | Neuropeptide Y (29-64), amide, human acetate is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity. |
In vitro | It is showed that Neuropeptide Y (29-64), amide, human acetate is able to protect cortical neurons from Aβ25-35?toxicity. 2 μM NPY abolishes the toxic effects of Aβ25-35?at 24 and 48 h. The same effect on neuronal survival is observed in neurons exposed to 1 μM and 0.5 μM Neuropeptide Y (29-64), amide, human acetate pretreatments. Pretreatment with Neuropeptide Y (29-64), amide, human acetate Increases NGF Synthesis, reduces NGF mRNA, and restores NGF release in cortical neurons exposed to Aβ35-25[1]. |
Relative Density. | no data available |
Sequence | H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
Sequence Short | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.