Shopping Cart
- Remove All
Your shopping cart is currently empty
Muscarinic toxin 3 (MT3), a potent non-competitive antagonist of mAChR and adrenoceptors, exhibits pIC50 values of 6.71 for M1, 8.79 for M4, 8.86 for α1A, 7.57 for α1B, 8.13 for α1D, 8.49 for α2A, <6.5 for α2B, and 7.29 for α2C receptors. MT3 notably demonstrates significant adrenoceptor activity [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Muscarinic toxin 3 (MT3), a potent non-competitive antagonist of mAChR and adrenoceptors, exhibits pIC50 values of 6.71 for M1, 8.79 for M4, 8.86 for α1A, 7.57 for α1B, 8.13 for α1D, 8.49 for α2A, <6.5 for α2B, and 7.29 for α2C receptors. MT3 notably demonstrates significant adrenoceptor activity [1]. |
| Synonyms | MT3 |
| Molecular Weight | 7379.35 |
| Formula | C319H489N89O97S8 |
| Cas No. | 873336-87-9 |
| Sequence | Leu-Thr-Cys-Val-Thr-Lys-Asn-Thr-Ile-Phe-Gly-Ile-Thr-Thr-Glu-Asn-Cys-Pro-Ala-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Trp-His-Tyr-Val-Ile-Pro-Arg-Tyr-Thr-Glu-Ile-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ile-Pro-Glu-Asn-Tyr-Asp-Ser-Ile-His-Cys-Cys-Lys-Thr-Asp-Lys-Cys-Asn |
| Sequence Short | LTCVTKNTIFGITTENCPAGQNLCFKRWHYVIPRYTEITRGCAATCPIPENYDSIHCCKTDKCNE (Disulfide bridge: Cys3-Cys24,Cys17-Cys42,Cys46-Cys57,Cys58-Cys63) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.