Your shopping cart is currently empty

Lunasin, a bioactive peptide derived from soybean, exhibits antioxidant, anti-inflammatory, anticancer, and anti-aging properties. It operates through an epigenetic mechanism linked to histone acetylation and has the ability to penetrate cells and impede the formation of oncospheres in cancer cells [1].

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $369 | 4-6 weeks | 4-6 weeks | |
| 5 mg | $889 | 4-6 weeks | 4-6 weeks | |
| 10 mg | $1,150 | 4-6 weeks | 4-6 weeks | |
| 25 mg | $1,590 | 4-6 weeks | 4-6 weeks | |
| 50 mg | $2,029 | 4-6 weeks | 4-6 weeks |
| Description | Lunasin, a bioactive peptide derived from soybean, exhibits antioxidant, anti-inflammatory, anticancer, and anti-aging properties. It operates through an epigenetic mechanism linked to histone acetylation and has the ability to penetrate cells and impede the formation of oncospheres in cancer cells [1]. |
| In vitro | Lunasin is composed of four sections, including a tail with aspartic acid (D) and an RGD motif. This RGD sequence is critical for Lunasin's internalization into cells and its anti-transformative functions, as well as its association with the inhibition of methionine adenosyltransferase formation in the A375 ALDHhigh melanoma cell line induced by Lunasin [1]. |
| Molecular Weight | 5028.32 |
| Formula | C204H321N65O78S3 |
| Cas No. | 496823-34-8 |
| Sequence | Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp |
| Sequence Short | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.