Shopping Cart
Remove All
Your shopping cart is currently empty
Lunasin, a bioactive peptide derived from soybean, exhibits antioxidant, anti-inflammatory, anticancer, and anti-aging properties. It operates through an epigenetic mechanism linked to histone acetylation and has the ability to penetrate cells and impede the formation of oncospheres in cancer cells [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $369 | 4-6 weeks | 4-6 weeks | |
| 5 mg | $889 | 4-6 weeks | 4-6 weeks | |
| 10 mg | $1,150 | 4-6 weeks | 4-6 weeks | |
| 25 mg | $1,590 | 4-6 weeks | 4-6 weeks | |
| 50 mg | $2,029 | 4-6 weeks | 4-6 weeks |
| Description | Lunasin, a bioactive peptide derived from soybean, exhibits antioxidant, anti-inflammatory, anticancer, and anti-aging properties. It operates through an epigenetic mechanism linked to histone acetylation and has the ability to penetrate cells and impede the formation of oncospheres in cancer cells [1]. |
| In vitro | Lunasin is composed of four sections, including a tail with aspartic acid (D) and an RGD motif. This RGD sequence is critical for Lunasin's internalization into cells and its anti-transformative functions, as well as its association with the inhibition of methionine adenosyltransferase formation in the A375 ALDHhigh melanoma cell line induced by Lunasin [1]. |
| Molecular Weight | 5028.32 |
| Formula | C204H321N65O78S3 |
| Cas No. | 496823-34-8 |
| Sequence | Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp |
| Sequence Short | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.