Shopping Cart
- Remove All
- Your shopping cart is currently empty
Lunasin, a bioactive peptide derived from soybean, exhibits antioxidant, anti-inflammatory, anticancer, and anti-aging properties. It operates through an epigenetic mechanism linked to histone acetylation and has the ability to penetrate cells and impede the formation of oncospheres in cancer cells [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $369 | 4-6 weeks | |
5 mg | $889 | 4-6 weeks | |
10 mg | $1,150 | 4-6 weeks | |
25 mg | $1,590 | 4-6 weeks | |
50 mg | $2,029 | 4-6 weeks |
Description | Lunasin, a bioactive peptide derived from soybean, exhibits antioxidant, anti-inflammatory, anticancer, and anti-aging properties. It operates through an epigenetic mechanism linked to histone acetylation and has the ability to penetrate cells and impede the formation of oncospheres in cancer cells [1]. |
In vitro | Lunasin is composed of four sections, including a tail with aspartic acid (D) and an RGD motif. This RGD sequence is critical for Lunasin's internalization into cells and its anti-transformative functions, as well as its association with the inhibition of methionine adenosyltransferase formation in the A375 ALDHhigh melanoma cell line induced by Lunasin [1]. |
Molecular Weight | 5028.32 |
Formula | C204H321N65O78S3 |
Cas No. | 496823-34-8 |
Sequence | Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp |
Sequence Short | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.