Shopping Cart
Remove All
Your shopping cart is currently empty
Lixisenatide acetate is a receptor agonist similar to glucagon-like peptide-1 (glp-1) for the treatment of type 2 diabetes mellitus (T2DM).

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $58 | In Stock | In Stock | |
| 5 mg | $118 | In Stock | In Stock | |
| 10 mg | $193 | In Stock | In Stock | |
| 25 mg | $323 | In Stock | In Stock | |
| 50 mg | $463 | In Stock | In Stock | |
| 100 mg | $630 | In Stock | In Stock | |
| 200 mg | $848 | - | In Stock |
| Description | Lixisenatide acetate is a receptor agonist similar to glucagon-like peptide-1 (glp-1) for the treatment of type 2 diabetes mellitus (T2DM). |
| Synonyms | Lixisenatide acetate |
| Molecular Weight | 5218.88 |
| Formula | C215H347N61O65S.6C2H4O2 |
| Cas No. | 1997361-87-1 |
| Smiles | CC[C@@H]([C@@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(NCC(N1CCC[C@H]1C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N2CCC[C@H]2C(N3CCC[C@H]3C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N)=O)CCCCN)=O)CCCCN)=O)CCCCN)=O)CCCCN)=O)CCCCN)=O)CCCCN)=O)CO)=O)=O)=O)C)=O)=O)CO)=O)CO)=O)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)CC(C)C)=O)CC4=CNC5=CC=CC=C45)=O)CCC(O)=O)=O)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](C(C)C)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H]([C@H](O)C)NC([C@@H](NC([C@H]([C@H](O)C)NC(CNC([C@@H](NC(CNC([C@H](CC6=CN=CN6)N)=O)=O)CCC(O)=O)=O)=O)=O)CC7=CC=CC=C7)=O)=O)CO)=O)CC(O)=O)=O)CC(C)C)=O)CO)=O)CCCCN)=O)CCC(N)=O)=O)CCSC)=O)CCC(O)=O)=O)CCC(O)=O)=O)CCC(O)=O)=O)C)=O)=O)CCCNC(N)=N)=O)CC(C)C)=O)CC8=CC=CC=C8)=O)C.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O |
| Relative Density. | no data available |
| Color | White |
| Appearance | Solid |
| Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2 |
| Sequence Short | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 |
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
| Solubility Information | DMSO: 10 mM, Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO
| |||||||||||||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.