Shopping Cart
- Remove All
- Your shopping cart is currently empty
Lixisenatide acetate is a receptor agonist similar to glucagon-like peptide-1 (glp-1) for the treatment of type 2 diabetes mellitus (T2DM).
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $58 | In Stock | |
5 mg | $118 | In Stock | |
10 mg | $193 | In Stock | |
25 mg | $323 | In Stock | |
50 mg | $463 | In Stock | |
100 mg | $630 | In Stock | |
200 mg | $848 | In Stock |
Description | Lixisenatide acetate is a receptor agonist similar to glucagon-like peptide-1 (glp-1) for the treatment of type 2 diabetes mellitus (T2DM). |
Synonyms | Lixisenatide acetate |
Molecular Weight | 5218.88 |
Formula | C215H347N61O65S.6C2H4O2 |
Cas No. | 1997361-87-1 |
Smiles | CC[C@@H]([C@@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(NCC(N1CCC[C@H]1C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N2CCC[C@H]2C(N3CCC[C@H]3C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N)=O)CCCCN)=O)CCCCN)=O)CCCCN)=O)CCCCN)=O)CCCCN)=O)CCCCN)=O)CO)=O)=O)=O)C)=O)=O)CO)=O)CO)=O)=O)=O)=O)CC(N)=O)=O)CCCCN)=O)CC(C)C)=O)CC4=CNC5=CC=CC=C45)=O)CCC(O)=O)=O)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](C(C)C)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H]([C@H](O)C)NC([C@@H](NC([C@H]([C@H](O)C)NC(CNC([C@@H](NC(CNC([C@H](CC6=CN=CN6)N)=O)=O)CCC(O)=O)=O)=O)=O)CC7=CC=CC=C7)=O)=O)CO)=O)CC(O)=O)=O)CC(C)C)=O)CO)=O)CCCCN)=O)CCC(N)=O)=O)CCSC)=O)CCC(O)=O)=O)CCC(O)=O)=O)CCC(O)=O)=O)C)=O)=O)CCCNC(N)=N)=O)CC(C)C)=O)CC8=CC=CC=C8)=O)C.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O |
Relative Density. | no data available |
Color | White |
Appearance | Solid |
Sequence | His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2 |
Sequence Short | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||||||||||||
Solubility Information | DMSO: 10 mM, Sonication is recommended. | ||||||||||||||||||||
Solution Preparation Table | |||||||||||||||||||||
DMSO
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.