Shopping Cart

Your shopping cart is currently empty

Lixisenatide

Name: Lixisenatide
Brand: TargetMol
SKU: TP1340
Price: 98 USD
Availability: InStock
Rating: 5 (10 reviews)

Copy Product Info

🥰Excellent

Synonyms:

Catalog No. TP1340 Copy Product Info

🥰Excellent

Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that primarily regulates glucose homeostasis by activating the GLP-1 signaling pathway. Beyond its glucose-lowering effects, lixisenatide suppresses inflammatory responses by downregulating pro-inflammatory cytokine expression and modulates signaling pathways such as Akt-MEK1/2. Additionally, it alleviates oxidative stress, mitochondrial dysfunction, and apoptosis, demonstrating potential value in research on metabolic diseases and inflammation-related conditions (e.g., diabetes and its complications).

Cas No. 320367-13-3

Pack Size	Price	USA Stock	Global Stock	Quantity
1 mg	$98	-	In Stock

For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)

Add to Cart

Add to Quotation

For research use only—not for human use. No sales to individuals. Use as intended only.

Questions

Batch Information

Select Batch

Appearance:Solid

Color:White

Resource Download

COA

Product Introduction

Bioactivity

Description

Chemical Properties

Molecular Weight	4858.49
Formula	C₂₁₅H₃₄₇N₆₁O₆₅S
Cas No.	320367-13-3
Relative Density.	no data available
Sequence	His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH₂
Sequence Short	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK

Storage & Solubility Information

Storage

Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

H2O: 80 mg/mL (16.47 mM), Sonication and heating are recommended.

Solution Preparation Table

H2O

	1mg	5mg	10mg	50mg
1 mM	0.2058 mL	1.0291 mL	2.0583 mL	10.2913 mL
5 mM	0.0412 mL	0.2058 mL	0.4117 mL	2.0583 mL
10 mM	0.0206 mL	0.1029 mL	0.2058 mL	1.0291 mL

Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.