Shopping Cart
- Remove All
- Your shopping cart is currently empty
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. It effectively blocks sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons, with IC50 values of 66.1 nM and 4.80 nM, respectively [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. It effectively blocks sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons, with IC50 values of 66.1 nM and 4.80 nM, respectively [1]. |
Alias | HWTX-I |
Molecular Weight | 3750.36 |
Formula | C161H246N48O44S6 |
Cas No. | 769973-37-7 |
Sequence | Ala-Cys-Lys-Gly-Val-Phe-Asp-Ala-Cys-Thr-Pro-Gly-Lys-Asn-Glu-Cys-Cys-Pro-Asn-Arg-Val-Cys-Ser-Asp-Lys-His-Lys-Trp-Cys-Lys-Trp-Lys-Leu (Disulfide bridge: Cys2-Cys17; Cys9-Cys22; Cys16-Cys29) |
Sequence Short | ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL (Disulfide bridge: Cys2-Cys17; Cys9-Cys22; Cys16-Cys29) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.