Shopping Cart
Remove All
Your shopping cart is currently empty
Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $397 | Inquiry | Inquiry | |
| 5 mg | $894 | Inquiry | Inquiry | |
| 10 mg | $1,339 | Inquiry | Inquiry | |
| 25 mg | $2,412 | Inquiry | Inquiry |
| Description | Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist. |
| In vitro | Glucagon-like peptide 1 (1-37), human acetate is produced by post-translational processing of proglucagon and acts as a regulator of various homeostatic events. GLP-1(1-37) is more stable than GLP-1(7-37), with an initial amount of peptide of 94.7% after exposure to mouse serum for 4 hours[1]. |
| In vivo | The administration of Glucagon-like peptide 1 (1-37), human acetate markedly decrease blood glucose levels at 30 min compared with the control group. Glucagon-like peptide 1 (1-37), human acetate decreased glycemic excursion in a dose-dependent manner[1]. |
| Relative Density. | no data available |
| Sequence | His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| Sequence Short | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.