Your shopping cart is currently empty

Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $397 | Inquiry | Inquiry | |
| 5 mg | $894 | Inquiry | Inquiry | |
| 10 mg | $1,339 | Inquiry | Inquiry | |
| 25 mg | $2,412 | Inquiry | Inquiry |
| Description | Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist. |
| In vitro | Glucagon-like peptide 1 (1-37), human acetate is produced by post-translational processing of proglucagon and acts as a regulator of various homeostatic events. GLP-1(1-37) is more stable than GLP-1(7-37), with an initial amount of peptide of 94.7% after exposure to mouse serum for 4 hours[1]. |
| In vivo | The administration of Glucagon-like peptide 1 (1-37), human acetate markedly decrease blood glucose levels at 30 min compared with the control group. Glucagon-like peptide 1 (1-37), human acetate decreased glycemic excursion in a dose-dependent manner[1]. |
| Relative Density. | no data available |
| Sequence | His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| Sequence Short | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.