Your shopping cart is currently empty

Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | 7-10 days | 7-10 days | |
| 500 mg | Inquiry | 7-10 days | 7-10 days |
| Description | Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency. |
| Molecular Weight | 3766.2 |
| Formula | C165H254N44O55S |
| Cas No. | 89750-15-2 |
| Relative Density. | no data available |
| Sequence | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
| Sequence Short | HADGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.