Your shopping cart is currently empty

GLP-1(7-36), amide TFA is a prominent intestinal hormone that stimulates glucose-induced insulin secretion from β cells[1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $182 | Inquiry | Inquiry | |
| 5 mg | $555 | Inquiry | Inquiry | |
| 10 mg | $881 | Inquiry | Inquiry |
| Description | GLP-1(7-36), amide TFA is a prominent intestinal hormone that stimulates glucose-induced insulin secretion from β cells[1]. |
| In vitro | Cells exposed to phorbol 12-myristate 13-acetate for 2 hours exhibited significantly increased concentrations of active GLP-1(7-36) Acetate (Human GLP-1-(7-36)-amide Acetate) in the media, surpassing those of the control group. Similarly, glucose treatment enhanced active GLP-1 secretion from cells in a dose-dependent manner. Furthermore, exposure to varying doses of palmitic, oleic, linoleic, or linolenic acid also stimulated active GLP-1 secretion from cells in a dose-dependent fashion, with unsaturated fatty acids, specifically oleic, linoleic, and linolenic acids, promoting greater active GLP-1 secretion than palmitic acid. Additionally, treating NCI-H716 cells with CPE led to a dose-dependent increase in media active GLP-1 concentrations, achieving a 37% rise at a concentration of 0.1% CPE[1]. |
| In vivo | Administering glucose orally increases active GLP-1(7-36) amide concentrations in portal blood within 10 minutes, with a significant reduction observed after 30 minutes. Similar administration of TO also boosts active GLP-1 levels at 10 minutes but returns to baseline by 60 minutes. Both glucose and TO independently enhance GLP-1 secretion in a dose-responsive manner, while their combined administration synergistically elevates peak GLP-1 concentrations. Mice treated with CPE exhibit higher active GLP-1 levels at both 10 and 30 minutes post-administration compared to control mice. Additionally, when glucose is given alongside CPE, active GLP-1 and insulin concentrations in the portal blood marginally increase in CPE-treated mice versus the controls. This model also notes that high-fat diet-induced C57BL/6J mice experience hyperglycemia and diminished glucose tolerance[1]. |
| Relative Density. | no data available |
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Sequence Short | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2 |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.