Shopping Cart
Remove All
Your shopping cart is currently empty
GIP (human) acetate is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP (human) acetate plays a vital role in lipid metabolism and the development of obesity.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $238 | - | In Stock | |
| 5 mg | $569 | - | In Stock | |
| 10 mg | $845 | - | In Stock | |
| 25 mg | $1,520 | - | In Stock | |
| 50 mg | $2,398 | - | In Stock | |
| 100 mg | $3,638 | - | In Stock |
| Description | GIP (human) acetate is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP (human) acetate plays a vital role in lipid metabolism and the development of obesity. |
| In vitro | GIP (human) acetate acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion. Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state[3]. |
| Synonyms | GIP (human) acetate(100040-31-1 Free base) |
| Relative Density. | no data available |
| Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
| Sequence Short | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | DMSO: 20 mg/mL, Sonication is recommended. H2O: 20 mg/mL, Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.