Shopping Cart
- Remove All
- Your shopping cart is currently empty
GIP (human) acetate is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP (human) acetate plays a vital role in lipid metabolism and the development of obesity.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $238 | In Stock | |
5 mg | $569 | In Stock | |
10 mg | $845 | In Stock | |
25 mg | $1,520 | In Stock | |
50 mg | $2,398 | In Stock | |
100 mg | $3,638 | In Stock |
Description | GIP (human) acetate is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP (human) acetate plays a vital role in lipid metabolism and the development of obesity. |
In vitro | GIP (human) acetate acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion. Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state[3]. |
Alias | GIP (human) acetate(100040-31-1 Free base) |
Relative Density. | no data available |
Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
Sequence Short | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | DMSO: 20 mg/mL, Sonication is recommended. H2O: 20 mg/mL, Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.