Shopping Cart
- Remove All
- Your shopping cart is currently empty
GIP (1-39) acetate is a gastric inhibitory peptide (GIP) purified from porcine intestine and stimulates insulin secretion.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $580 | In Stock | |
5 mg | $1,150 | In Stock | |
10 mg | $1,570 | In Stock | |
25 mg | $2,330 | In Stock | |
50 mg | $3,150 | In Stock | |
100 mg | $4,170 | In Stock |
Description | GIP (1-39) acetate is a gastric inhibitory peptide (GIP) purified from porcine intestine and stimulates insulin secretion. |
In vitro | GIP (1-39) acetate (100 nM) increases intracellular Ca2+ concentration ([Ca2+]i), and enhances exocytosis assessed by membrane capacitance measurement[1]. |
Synonyms | GIP (1-39) acetate(725474-97-5 Free base) |
Sequence | H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-OH |
Sequence Short | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.