Shopping Cart
Remove All
Your shopping cart is currently empty
Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $1,680 | 35 days | 35 days |
| Description | Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP. |
| Molecular Weight | 4633.21 |
| Formula | C210H316N56O61S |
| Cas No. | 725474-97-5 |
| Relative Density. | no data available |
| Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn |
| Sequence Short | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
| Solubility Information | H2O: 10 mg/mL (2.16 mM), Sonication is recommended. | ||||||||||
Solution Preparation Table | |||||||||||
H2O
| |||||||||||
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.