Shopping Cart
- Remove All
- Your shopping cart is currently empty
Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $1,680 | 35 days |
Description | Endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP. |
Molecular Weight | 4633.21 |
Formula | C210H316N56O61S |
Cas No. | 725474-97-5 |
Relative Density. | no data available |
Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn |
Sequence Short | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
Solubility Information | H2O: 10 mg/mL (2.16 mM), Sonication is recommended. | ||||||||||
Solution Preparation Table | |||||||||||
H2O
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.