Shopping Cart
- Remove All
- Your shopping cart is currently empty
GIP (1-30) amide, porcine acetate is an agonist of fully glucose-dependent insulinotropic polypeptide (GIP) receptor. GIP (1-30) amide, porcine acetate can weakly inhibit gastric acid secretion and strongly stimulate insulin.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $79 | In Stock | |
5 mg | $165 | In Stock | |
10 mg | $273 | In Stock | |
25 mg | $448 | In Stock | |
50 mg | $630 | In Stock | |
100 mg | $852 | In Stock | |
500 mg | $1,710 | In Stock |
Description | GIP (1-30) amide, porcine acetate is an agonist of fully glucose-dependent insulinotropic polypeptide (GIP) receptor. GIP (1-30) amide, porcine acetate can weakly inhibit gastric acid secretion and strongly stimulate insulin. |
Molecular Weight | 3611.04 |
Formula | C164H249N41O49S |
Smiles | CC(O)=O.NCCCC[C@@H](C(N)=O)NC([C@H](CCC(N)=O)NC([C@H](C)NC([C@H](CC(C)C)NC([C@H](CC(C)C)NC([C@H](CC1=CNC2=C1C=CC=C2)NC([C@H](CC(N)=O)NC([C@H](C(C)C)NC([C@H](CC3=CC=CC=C3)NC([C@H](CC(O)=O)NC([C@H](CCC(N)=O)NC([C@H](CCC(N)=O)NC([C@H](CCCNC(N)=N)NC([C@H]([C@@H](C)CC)NC([C@H](CCCCN)NC([C@H](CC(O)=O)NC([C@H](CCSC)NC([C@H](C)NC([C@H]([C@@H](C)CC)NC([C@H](CO)NC([C@H](CC4=CC=C(O)C=C4)NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H]([C@@H](C)CC)NC([C@H](CC5=CC=CC=C5)NC([C@H]([C@H](O)C)NC(CNC([C@H](CCC(O)=O)NC([C@H](C)NC([C@H](CC6=CC=C(O)C=C6)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O |
Sequence | Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys |
Sequence Short | YAEGTFISDYSIAMDKIRQQDFVNWLLAQK |
Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.