Shopping Cart
- Remove All
- Your shopping cart is currently empty
Galanin-Like Peptide (rat), a neuropeptide comprising 60 amino acids, plays a crucial role in regulating feeding, body weight, and energy metabolism [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Galanin-Like Peptide (rat), a neuropeptide comprising 60 amino acids, plays a crucial role in regulating feeding, body weight, and energy metabolism [1]. |
Molecular Weight | 6502.34 |
Formula | C288H461N87O83S |
Cas No. | 245114-97-0 |
Sequence | Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Ser-Ser-Lys-Ala-Asn-Gln-Gly-Arg-Lys-Thr-Asp-Ser-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-Arg-Ser-Pro-Arg-Met-Thr |
Sequence Short | APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.