Shopping Cart
- Remove All
- Your shopping cart is currently empty
Galanin (1-29)(rat, mouse) TFA acts as a non-selective agonist for galanin receptors, exhibiting affinities (Kis) of 0.98 nM for GAL1, 1.48 nM for GAL2, and 1.47 nM for GAL3, respectively, and possesses an anticonvulsant effect [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Galanin (1-29)(rat, mouse) TFA acts as a non-selective agonist for galanin receptors, exhibiting affinities (Kis) of 0.98 nM for GAL1, 1.48 nM for GAL2, and 1.47 nM for GAL3, respectively, and possesses an anticonvulsant effect [1] [2]. |
Molecular Weight | 3278.47 |
Formula | C143H212F3N43O43 |
Sequence | Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 |
Sequence Short | GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.