Shopping Cart
- Remove All
- Your shopping cart is currently empty
Dendrotoxin-I, a neurotoxin from Dendroaspis snake venom, potently blocks K⁺ channels, specifically targeting voltage-gated potassium channel subunits KV1.1 and KV1.2 [1] [2] [3].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Dendrotoxin-I, a neurotoxin from Dendroaspis snake venom, potently blocks K⁺ channels, specifically targeting voltage-gated potassium channel subunits KV1.1 and KV1.2 [1] [2] [3]. |
Targets&IC50 | Kv1.2:0.13-50 nM, Kv1.6:0.13-50 nM, Kv1.1:0.13-50 nM |
In vivo | Dendrotoxin-I (5 mg/kg; IV) significantly inhibits tumor growth when combined with hyperthermia [3]. |
Synonyms | DTX-I |
Molecular Weight | 7149.24 |
Formula | C312H491N99O83S6 |
Cas No. | 107950-33-4 |
Sequence | Gln-Pro-Leu-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Gln-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Gly-Phe-Thr-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Arg-Lys (Disulfide brid |
Sequence Short | QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.