Your shopping cart is currently empty

Dendrotoxin-I (DTX-I) TFA is an effective blocker of K+ channels, displaying IC50 values of 0.13-50 nM against voltage-gated potassium channel subunits KV1.1, KV1.2, and KV1.6. This neurotoxin also holds potential for use in cancer research.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Dendrotoxin-I (DTX-I) TFA is an effective blocker of K+ channels, displaying IC50 values of 0.13-50 nM against voltage-gated potassium channel subunits KV1.1, KV1.2, and KV1.6. This neurotoxin also holds potential for use in cancer research. |
| Targets&IC50 | Kv1.1 channel:0.13-50 nM, Kv1.6 channel:0.13-50 nM, Kv1.2 channel:0.13-50 nM |
| In vivo | Dendrotoxin-I (5 mg/kg;) TFA, when combined with hyperthermia, demonstrated notable inhibition of tumor growth. In an animal model using nude mice implanted with MCF-7 cells [3], the compound was administered intravenously at a dosage of 5 mg/kg. Initially, it exhibited significant effects in suppressing tumor growth, although it failed to maintain this inhibitory effect in the later stages of the treatment. |
| Synonyms | DTX-I TFA |
| Sequence | Gln-Pro-Leu-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Gln-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Gly-Phe-Thr-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Arg-Lys (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53) |
| Sequence Short | QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.