Shopping Cart
- Remove All
- Your shopping cart is currently empty
Amylin (8-37), rat, a truncated analog of native Amylin, selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin, also known as islet amyloid precursor peptide (IAPP), is co-secreted with insulin from pancreatic β-cells.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $211 | Backorder | |
5 mg | $792 | Backorder |
Description | Amylin (8-37), rat, a truncated analog of native Amylin, selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin, also known as islet amyloid precursor peptide (IAPP), is co-secreted with insulin from pancreatic β-cells. |
Alias | Amylin (8-37) (mouse, rat) |
Molecular Weight | 3200.61 |
Formula | C140H227N43O43 |
Cas No. | 138398-61-5 |
Relative Density. | 1.51 g/cm3 (Predicted) |
Sequence | Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 |
Sequence Short | ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.