Your shopping cart is currently empty

NN1213 (Peptide 21) is a long-acting human amylin peptide analogue that functions as a selective amylin receptor agonist. It has an EC50 of 0.177 nM for hAMY3R and 0.262 nM for rAMY3R. In both rat and dog models, NN1213 significantly reduces appetite and is utilized in anti-obesity research.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | NN1213 (Peptide 21) is a long-acting human amylin peptide analogue that functions as a selective amylin receptor agonist. It has an EC50 of 0.177 nM for hAMY3R and 0.262 nM for rAMY3R. In both rat and dog models, NN1213 significantly reduces appetite and is utilized in anti-obesity research. |
| Sequence | {Lys(γGlu-γGlu-C20 diacid)}-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asp-Phe-Leu-Arg-His-Ser-Ser-Pro-Asn-Phe-Gly-Ala-Ile-Pro-Ser-Ser-Thr-Asn-Val-Gly-Ser-Arg-Thr-Tyr-NH2 (disulfide bridge:Cys2-Cys7) |
| Sequence Short | {Lys(γGlu-γGlu-C20 diacid)}-CNTATCATQRLADFLRHSSPNFGAIPSSTNVGSRTY (disulfide bridge:Cys2-Cys7) |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.