Shopping Cart
Remove All
Your shopping cart is currently empty
Selective, high affinity, non-competitive α1A adrenoceptor antagonist (Ki = 0.35 nM). Exhibits no significant activity against a range of other GPCRs, including α2A, β1 and β2 adrenoceptors. Antagonizes effects of phenylephrine on isolated rabbit prostate muscle in vitro and on intra-urethral pressure in rats.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $1,674 | Inquiry | Inquiry |
| Description | Selective, high affinity, non-competitive α1A adrenoceptor antagonist (Ki = 0.35 nM). Exhibits no significant activity against a range of other GPCRs, including α2A, β1 and β2 adrenoceptors. Antagonizes effects of phenylephrine on isolated rabbit prostate muscle in vitro and on intra-urethral pressure in rats. |
| Molecular Weight | 7283.22 |
| Formula | C310H481N87O100S8 |
| Relative Density. | no data available |
| Sequence | Leu-Thr-Cys-Val-Thr-Ser-Lys-Ser-Ile-Phe-Gly-Ile-Thr-Thr-Glu-Asp-Cys-Pro-Asp-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Arg-His-Tyr-Val-Val-Pro-Lys-Ile-Tyr-Asp-Ser-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ile-Pro-Glu-Asn-Tyr-Asp-Ser-Ile-His-Cys-Cys-Lys-Thr-Asp-Lys-Cys-Asn |
| Sequence Short | LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE (Disulfide bonds: Cys3-Cys24, Cys17-Cys42, Cys46-Cys57, Cys58-Cys63) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 1 mg/mL (0.14 mM), Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.