Shopping Cart
- Remove All
- Your shopping cart is currently empty
Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $198 | Backorder | |
5 mg | $792 | Backorder |
Description | Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin. |
Alias | 22-52-Adrenomedullin (human) |
Molecular Weight | 3576.04 |
Formula | C159H252N46O48 |
Cas No. | 159899-65-7 |
Relative Density. | 1.50 g/cm3 (Predicted) |
Sequence | Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 |
Sequence Short | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.