Shopping Cart
- Remove All
- Your shopping cart is currently empty
Adrenomedullin (AM) (1-52), human, is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $427 | Backorder |
Description | Adrenomedullin (AM) (1-52), human, is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer. |
Alias | Human adrenomedullin-(1-52)-NH2 |
Molecular Weight | 6028.82 |
Formula | C264H406N80O77S3 |
Cas No. | 148498-78-6 |
Relative Density. | no data available |
Sequence | Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21) |
Sequence Short | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys16-Cys21) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.