Shopping Cart
- Remove All
- Your shopping cart is currently empty
Adrenomedullin (AM) (22-52), human [22-52-Adrenomedullin human], TFA, is a C-terminal truncated analogue of adrenomedullin and acts as an adrenomedullin receptor antagonist.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | Adrenomedullin (AM) (22-52), human [22-52-Adrenomedullin human], TFA, is a C-terminal truncated analogue of adrenomedullin and acts as an adrenomedullin receptor antagonist. |
Synonyms | 22-52-Adrenomedullin (human) (TFA) |
Molecular Weight | 3690.06 |
Formula | C161H253N46F3O50 |
Relative Density. | 1.31g/cm3 |
Sequence | Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 |
Sequence Short | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.