Shopping Cart
- Remove All
- Your shopping cart is currently empty
Adrenocorticotropic Hormone (ACTH) (1-39), human, is an agonist of the melanocortin receptor.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $58 | In Stock | |
5 mg | $137 | In Stock | |
10 mg | $225 | In Stock | |
25 mg | $478 | In Stock | |
50 mg | $685 | In Stock | |
100 mg | $953 | In Stock | |
200 mg | $1,280 | In Stock |
Description | Adrenocorticotropic Hormone (ACTH) (1-39), human, is an agonist of the melanocortin receptor. |
Synonyms | Adrenocorticotropic Hormone (ACTH) (1-39), human, ACTH (1-39), human |
Molecular Weight | 4541.14 |
Formula | C207H308N56O58S |
Cas No. | 12279-41-3 |
Smiles | CSCCC(NC(=O)C(CO)NC(=O)C(Cc1ccc(O)cc1)NC(=O)C(N)CO)C(=O)NC(CCC(O)=O)C(=O)NC(Cc1c[nH]cn1)C(=O)NC(Cc1ccccc1)C(=O)NC(CCCNC(N)=N)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NCC(=O)NC(CCCCN)C(=O)N1CCCC1C(=O)NC(C(C)C)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCNC(N)=N)C(=O)NC(CCCNC(N)=N)C(=O)N1CCCC1C(=O)NC(C(C)C)C(=O)NC(CCCCN)C(=O)NC(C(C)C)C(=O)NC(Cc1ccc(O)cc1)C(=O)N1CCCC1C(=O)NC(CC(N)=O)C(=O)NCC(=O)NC(C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(O)=O)C(=O)NC(CCC(O)=O)C(=O)NC(CO)C(=O)NC(C)C(=O)NC(CCC(O)=O)C(=O)NC(C)C(=O)NC(Cc1ccccc1)C(=O)N1CCCC1C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(Cc1ccccc1)C(O)=O |
Relative Density. | no data available |
Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
Sequence Short | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. | ||||||||||
Solubility Information | DMSO: 2.5 mM, Sonication is recommended. | ||||||||||
Solution Preparation Table | |||||||||||
DMSO
|
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.