Your shopping cart is currently empty

β-Amyloid (1-40), FAM-labeled, is a β-Amyloid (1-40) peptide tagged with a FAM fluorescent label, exhibiting an excitation wavelength (λ ex) of 492 nm and an emission wavelength (λ em) of 518 nm.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | β-Amyloid (1-40), FAM-labeled, is a β-Amyloid (1-40) peptide tagged with a FAM fluorescent label, exhibiting an excitation wavelength (λ ex) of 492 nm and an emission wavelength (λ em) of 518 nm. |
| In vitro | The transport of fluorescently labeled Aβ42, both FAM-labeled and Fluor 488-labeled Human β-Amyloid (1-42), as well as scrambled Aβ42 (FAM-labeled scrambled β-Amyloid (1-42)), across an endothelial monolayer, is analyzed in an in vitro blood-brain barrier (BBB) model, utilizing transendothelial electrical resistance (TEER) to monitor changes over time (specifically over 120 minutes, with or without the presence of Aβ24). It's observed that the presence of Human β-Amyloid (1-24) at a concentration of 1 μM results in the retention of H-Aβ42, which impairs its efflux from the BBB, thus hindering the molecule's effective clearance. When FAM-labeled or Fluor 488-conjugated H-Aβ42 is applied to the apical side of the cell inserts, it demonstrates successful cross-BBB migration, unlike the FAM-labeled scrambled β-Amyloid (1-42), which does not efficiently cross. |
| Cas No. | 1678416-08-4 |
| Sequence | FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Sequence Short | FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.