Your shopping cart is currently empty

Urocortin II, mouse, is a selective and potent endogenous peptide agonist for the type-2 corticotropin-releasing factor (CRF2) receptor, displaying K_i values of 0.66 nM for CRFR2 and >100 nM for CRFR1, signifying its high specificity. It engages CRF2 receptors through mechanisms dependent on cAMP/PKA and Ca2+/CaMKII. Additionally, Urocortin II, mouse is localized in specific regions of the central nervous system, influencing central neurons that process visceral sensory information and regulate autonomic functions [1] [2] [3].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Urocortin II, mouse, is a selective and potent endogenous peptide agonist for the type-2 corticotropin-releasing factor (CRF2) receptor, displaying K_i values of 0.66 nM for CRFR2 and >100 nM for CRFR1, signifying its high specificity. It engages CRF2 receptors through mechanisms dependent on cAMP/PKA and Ca2+/CaMKII. Additionally, Urocortin II, mouse is localized in specific regions of the central nervous system, influencing central neurons that process visceral sensory information and regulate autonomic functions [1] [2] [3]. |
| Targets&IC50 | CRFR2:0.66 nM (Ki), CRFR1:﹥100 nM (Ki) |
| Molecular Weight | 4152.96 |
| Formula | C187H320N56O50 |
| Cas No. | 330648-32-3 |
| Sequence | Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2 |
| Sequence Short | VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.