Shopping Cart
- Remove All
- Your shopping cart is currently empty
TAT-DEF-Elk-1 is a cell-penetrating peptide Elk-1 inhibitor.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 mg | Inquiry | Backorder | |
500 mg | Inquiry | Backorder |
Description | TAT-DEF-Elk-1 is a cell-penetrating peptide Elk-1 inhibitor. |
Targets&IC50 | ELK1: |
In vitro | Elk-1 phosphorylation on Ser383/389 simultaneously induces Elk-1 nuclear translocation and SRE-dependent gene expression. TAT-DEF-Elk-1 (5 μM for 2 hours) significantly inhibits c-Fos, Zif268, and JunB without affecting c-Jun expression. Additionally, TAT-DEF-Elk-1 (5-10 μM for 1 hour) specifically inhibits glutamate-induced Elk-1 activation without interfering with ERK, MSK-1, or CREB phosphorylation [1]. |
In vivo | TAT-DEF-Elk-1 (i.p.; 1mg/kg; daily; 14 days) reflects antidepressant efficacy in mice, it decreases immobility similar to the antidepressant desipramine and fluoxetine [2]. |
Synonyms | TDE |
Molecular Weight | 3561.136 |
Formula | C155H259N57O40 |
Cas No. | 1220751-16-5 |
Relative Density. | 1.53 g/cm3 (Predicted) |
Sequence Short | GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.