Shopping Cart
Remove All
Your shopping cart is currently empty
TAT-DEF-Elk-1 is a cell-penetrating peptide Elk-1 inhibitor.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | TAT-DEF-Elk-1 is a cell-penetrating peptide Elk-1 inhibitor. |
| Targets&IC50 | ELK1: |
| In vitro | Elk-1 phosphorylation on Ser383/389 simultaneously induces Elk-1 nuclear translocation and SRE-dependent gene expression. TAT-DEF-Elk-1 (5 μM for 2 hours) significantly inhibits c-Fos, Zif268, and JunB without affecting c-Jun expression. Additionally, TAT-DEF-Elk-1 (5-10 μM for 1 hour) specifically inhibits glutamate-induced Elk-1 activation without interfering with ERK, MSK-1, or CREB phosphorylation [1]. |
| In vivo | TAT-DEF-Elk-1 (i.p.; 1mg/kg; daily; 14 days) reflects antidepressant efficacy in mice, it decreases immobility similar to the antidepressant desipramine and fluoxetine [2]. |
| Synonyms | TDE |
| Molecular Weight | 3561.136 |
| Formula | C155H259N57O40 |
| Cas No. | 1220751-16-5 |
| Smiles | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CN)C(C)C)C(O)=O |
| Relative Density. | 1.53 g/cm3 (Predicted) |
| Sequence Short | GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.