Shopping Cart
Remove All
Your shopping cart is currently empty
TAT-DEF-Elk-1 acetate is a cell-penetrating peptide inhibitor of ERK1/2 kinase phosphorylated Elk-1 with antitumor and antidepressant activity.TAT-DEF-Elk-1 acetate inhibits the phosphorylation of Elk-1, inhibits Elk-1 nuclear TAT-DEF-Elk-1 acetate inhibits Elk-1 phosphorylation and Elk-1 nuclear translocation, and can be used to study depression.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $125 | In Stock | In Stock | |
| 5 mg | $373 | In Stock | In Stock | |
| 10 mg | $623 | - | In Stock | |
| 25 mg | $993 | - | In Stock |
| Description | TAT-DEF-Elk-1 acetate is a cell-penetrating peptide inhibitor of ERK1/2 kinase phosphorylated Elk-1 with antitumor and antidepressant activity.TAT-DEF-Elk-1 acetate inhibits the phosphorylation of Elk-1, inhibits Elk-1 nuclear TAT-DEF-Elk-1 acetate inhibits Elk-1 phosphorylation and Elk-1 nuclear translocation, and can be used to study depression. |
| In vitro | Phosphorylation of Elk-1 on Ser383/389 has dual functions, triggering Elk-1 nuclear translocation and SRE-dependent gene expression; TAT-DEF-Elk-1 (5 μM; 2 h) treatment significantly inhibited c - Fos, Zif268, and JunB, but has no effect on c-Jun expression; TAT-DEF-Elk-1 (5-10 μM; 1 hour) specifically inhibits glutamate-induced elk-1 activation without interfering with ERK , MSK-1 or CREB phosphorylation. [1] |
| In vivo | TAT-DEF-Elk-1 (ip; 1 mg/kg; daily; 14 days) reflected antidepressant efficacy in mice, reducing immobility similar to the reference antidepressants fluoxetine and desipramine (DMI).[2] |
| Synonyms | TED acetate, TAT-DEF-Elk-1 acetate(1220751-16-5 Free base) |
| Molecular Weight | 3621.19 |
| Formula | C157H263N57O42 |
| Smiles | O=C(N1[C@@H](CCC1)C(N[C@@H](CO)C(N2[C@@H](CCC2)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CC3=CC=CC=C3)C(N4[C@@H](CCC4)C(N[C@@H](CO)C(N[C@@H](CO)C(NCC(N[C@@H](CO)C(N[C@@H](C)C(N[C@@H](CCC(N)=O)C(N[C@@H](C(C)C)C(N[C@H](C(N[C@H](C(O)=O)[C@@H](C)CC)=O)CC5=CN=CN5)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC6=CC=CC=C6)=O)=O)=O)=O)=O)=O)=O)[C@H]7N(CCC7)C([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCC(N)=O)NC([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@@H](NC(CN)=O)CCCNC(N)=N)=O)=O)=O)=O)=O)=O)=O)=O)=O.CC(O)=O |
| Color | White |
| Appearance | Solid |
| Sequence | H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Ser-Pro-Ala-Lys-Leu-Ser-Phe-Gln-Phe-Pro-Ser-Ser-Gly-Ser-Ala-Gln-Val-His-Ile-OH |
| Sequence Short | GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI |
| Storage | store at low temperature,keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.