Shopping Cart

Your shopping cart is currently empty

TAT-DEF-Elk-1 acetate

Name: TAT-DEF-Elk-1 acetate
Brand: TargetMol
SKU: T81038L
Price: 125 USD
Availability: InStock
Rating: 5 (10 reviews)

Copy Product Info

😃Good

Catalog No. T81038L

Alias TED acetate, TAT-DEF-Elk-1 acetate(1220751-16-5 Free base)

TAT-DEF-Elk-1 acetate is a cell-penetrating peptide inhibitor of ERK1/2 kinase phosphorylated Elk-1 with antitumor and antidepressant activity.TAT-DEF-Elk-1 acetate inhibits the phosphorylation of Elk-1, inhibits Elk-1 nuclear TAT-DEF-Elk-1 acetate inhibits Elk-1 phosphorylation and Elk-1 nuclear translocation, and can be used to study depression.

TAT-DEF-Elk-1 acetate

Copy Product Info

😃Good

Purity: 99.88%

Catalog No. T81038LAlias TED acetate, TAT-DEF-Elk-1 acetate(1220751-16-5 Free base)

Pack Size	Price	USA Warehouse	Global Warehouse
1 mg	$125	In Stock	In Stock
5 mg	$373	In Stock	In Stock
10 mg	$623	-	In Stock
25 mg	$993	-	In Stock

Add to Cart

Add to Quotation

In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Questions

Batch Information

Select Batch

Purity:99.88%

Appearance:Solid

Color:White

Resource Download

COA HPLC MS

Product Introduction

Bioactivity

Description	TAT-DEF-Elk-1 acetate is a cell-penetrating peptide inhibitor of ERK1/2 kinase phosphorylated Elk-1 with antitumor and antidepressant activity.TAT-DEF-Elk-1 acetate inhibits the phosphorylation of Elk-1, inhibits Elk-1 nuclear TAT-DEF-Elk-1 acetate inhibits Elk-1 phosphorylation and Elk-1 nuclear translocation, and can be used to study depression.
In vitro	Phosphorylation of Elk-1 on Ser383/389 has dual functions, triggering Elk-1 nuclear translocation and SRE-dependent gene expression; TAT-DEF-Elk-1 (5 μM; 2 h) treatment significantly inhibited c - Fos, Zif268, and JunB, but has no effect on c-Jun expression; TAT-DEF-Elk-1 (5-10 μM; 1 hour) specifically inhibits glutamate-induced elk-1 activation without interfering with ERK , MSK-1 or CREB phosphorylation. [1]
In vivo	TAT-DEF-Elk-1 (ip; 1 mg/kg; daily; 14 days) reflected antidepressant efficacy in mice, reducing immobility similar to the reference antidepressants fluoxetine and desipramine (DMI).[2]
Synonyms	TED acetate, TAT-DEF-Elk-1 acetate(1220751-16-5 Free base)

Chemical Properties

Molecular Weight	3621.19
Formula	C₁₅₇H₂₆₃N₅₇O₄₂
Smiles	O=C(N1[C@@H](CCC1)C(N[C@@H](CO)C(N2[C@@H](CCC2)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CC3=CC=CC=C3)C(N4[C@@H](CCC4)C(N[C@@H](CO)C(N[C@@H](CO)C(NCC(N[C@@H](CO)C(N[C@@H](C)C(N[C@@H](CCC(N)=O)C(N[C@@H](C(C)C)C(N[C@H](C(N[C@H](C(O)=O)[C@@H](C)CC)=O)CC5=CN=CN5)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC6=CC=CC=C6)=O)=O)=O)=O)=O)=O)=O)[C@H]7N(CCC7)C([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCC(N)=O)NC([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@@H](NC(CN)=O)CCCNC(N)=N)=O)=O)=O)=O)=O)=O)=O)=O)=O.CC(O)=O
Sequence	H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Ser-Pro-Ala-Lys-Leu-Ser-Phe-Gln-Phe-Pro-Ser-Ser-Gly-Ser-Ala-Gln-Val-His-Ile-OH
Sequence Short	GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI

Storage & Solubility Information

Storage

store at low temperature,keep away from moisture | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Calculator

Molarity Calculator
Dilution Calculator
Reconstitution Calculator
Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:

For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments

and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent

10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH₂O , the resulting working solution concentration would be 2 mg/mL.

Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSO TargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSO TargetMol | reagent stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.

2) Add 50 μL Tween 80 and mix well until fully clarified.

3) Add 450 μL Saline,PBS or ddH₂O TargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.

All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc