Your shopping cart is currently empty

TAT-DEF-Elk-1 acetate is a cell-penetrating peptide inhibitor of ERK1/2 kinase phosphorylated Elk-1 with antitumor and antidepressant activity.TAT-DEF-Elk-1 acetate inhibits the phosphorylation of Elk-1, inhibits Elk-1 nuclear TAT-DEF-Elk-1 acetate inhibits Elk-1 phosphorylation and Elk-1 nuclear translocation, and can be used to study depression.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $125 | In Stock | In Stock | |
| 5 mg | $373 | In Stock | In Stock | |
| 10 mg | $623 | - | In Stock | |
| 25 mg | $993 | - | In Stock |
| Description | TAT-DEF-Elk-1 acetate is a cell-penetrating peptide inhibitor of ERK1/2 kinase phosphorylated Elk-1 with antitumor and antidepressant activity.TAT-DEF-Elk-1 acetate inhibits the phosphorylation of Elk-1, inhibits Elk-1 nuclear TAT-DEF-Elk-1 acetate inhibits Elk-1 phosphorylation and Elk-1 nuclear translocation, and can be used to study depression. |
| In vitro | Phosphorylation of Elk-1 on Ser383/389 has dual functions, triggering Elk-1 nuclear translocation and SRE-dependent gene expression; TAT-DEF-Elk-1 (5 μM; 2 h) treatment significantly inhibited c - Fos, Zif268, and JunB, but has no effect on c-Jun expression; TAT-DEF-Elk-1 (5-10 μM; 1 hour) specifically inhibits glutamate-induced elk-1 activation without interfering with ERK , MSK-1 or CREB phosphorylation. [1] |
| In vivo | TAT-DEF-Elk-1 (ip; 1 mg/kg; daily; 14 days) reflected antidepressant efficacy in mice, reducing immobility similar to the reference antidepressants fluoxetine and desipramine (DMI).[2] |
| Synonyms | TED acetate, TAT-DEF-Elk-1 acetate(1220751-16-5 Free base) |
| Molecular Weight | 3621.19 |
| Formula | C157H263N57O42 |
| Smiles | O=C(N1[C@@H](CCC1)C(N[C@@H](CO)C(N2[C@@H](CCC2)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CO)C(N[C@H](C(N[C@@H](CCC(N)=O)C(N[C@@H](CC3=CC=CC=C3)C(N4[C@@H](CCC4)C(N[C@@H](CO)C(N[C@@H](CO)C(NCC(N[C@@H](CO)C(N[C@@H](C)C(N[C@@H](CCC(N)=O)C(N[C@@H](C(C)C)C(N[C@H](C(N[C@H](C(O)=O)[C@@H](C)CC)=O)CC5=CN=CN5)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC6=CC=CC=C6)=O)=O)=O)=O)=O)=O)=O)[C@H]7N(CCC7)C([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCC(N)=O)NC([C@H](CCCNC(N)=N)NC([C@H](CCCNC(N)=N)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@@H](NC(CN)=O)CCCNC(N)=N)=O)=O)=O)=O)=O)=O)=O)=O)=O.CC(O)=O |
| Sequence | H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Ser-Pro-Ala-Lys-Leu-Ser-Phe-Gln-Phe-Pro-Ser-Ser-Gly-Ser-Ala-Gln-Val-His-Ile-OH |
| Sequence Short | GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.