Your shopping cart is currently empty

TAT-DEF-Elk-1 TFA is a cell-penetrating peptide Elk-1 inhibitor, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
| Description | TAT-DEF-Elk-1 TFA is a cell-penetrating peptide Elk-1 inhibitor, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity |
| Targets&IC50 | ELK1: |
| In vitro | Elk-1 phosphorylation on Ser383/389 has a dual function and triggers both Elk-1 nuclear translocation and SRE-dependent gene expression. TAT-DEF-Elk-1 (5 μM; 2 hours) treatment shows significant inhibition of c-Fos, Zif268, and JunB, but has no effects on c-Jun expression. TAT-DEF-Elk-1 (5-10 μM; 1 hour) specifically inhibits glutamate-induced elk-1 activation and does not interfere with ERK, MSK-1, or CREB phosphorylation [1]. |
| In vivo | TAT-DEF-Elk-1 (i.p.; 1mg/kg; daily; 14 days) reflects antidepressant efficacy in mice, it decreases immobility similar to the antidepressant desipramine and fluoxetine [2]. |
| Synonyms | TDE TFA, TAT-DEF-Elk-1 TFA |
| Molecular Weight | 3675.09 |
| Formula | C157H260N57F3O42 |
| Relative Density. | no data available |
| Sequence | H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Ser-Pro-Ala-Lys-Leu-Ser-Phe-Gln-Phe-Pro-Ser-Ser-Gly-Ser-Ala-Gln-Val-His-Ile-OH |
| Sequence Short | GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.