Shopping Cart
Remove All
Your shopping cart is currently empty
TAT-DEF-Elk-1 TFA (1220751-16-5 free base)
Copy Product Info
😃Good
Catalog No. TP2157L
Alias TDE TFA, TAT-DEF-Elk-1 TFA
TAT-DEF-Elk-1 TFA is a cell-penetrating peptide Elk-1 inhibitor, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity
TAT-DEF-Elk-1 TFA (1220751-16-5 free base)
TAT-DEF-Elk-1 TFA (1220751-16-5 free base)
Copy Product Info😃Good
Catalog No. TP2157LAlias TDE TFA, TAT-DEF-Elk-1 TFA
TAT-DEF-Elk-1 TFA is a cell-penetrating peptide Elk-1 inhibitor, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 mg | Inquiry | Inquiry | Inquiry | |
| 500 mg | Inquiry | Inquiry | Inquiry |
Add to Quotation
In Stock Estimated shipping dateUSA Warehouse[1-2 days] Global Warehouse[5-7 days]
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.
Resource Download
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | TAT-DEF-Elk-1 TFA is a cell-penetrating peptide Elk-1 inhibitor, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity |
| Targets&IC50 | ELK1: |
| In vitro | Elk-1 phosphorylation on Ser383/389 has a dual function and triggers both Elk-1 nuclear translocation and SRE-dependent gene expression. TAT-DEF-Elk-1 (5 μM; 2 hours) treatment shows significant inhibition of c-Fos, Zif268, and JunB, but has no effects on c-Jun expression. TAT-DEF-Elk-1 (5-10 μM; 1 hour) specifically inhibits glutamate-induced elk-1 activation and does not interfere with ERK, MSK-1, or CREB phosphorylation [1]. |
| In vivo | TAT-DEF-Elk-1 (i.p.; 1mg/kg; daily; 14 days) reflects antidepressant efficacy in mice, it decreases immobility similar to the antidepressant desipramine and fluoxetine [2]. |
| Synonyms | TDE TFA, TAT-DEF-Elk-1 TFA |
| Molecular Weight | 3675.09 |
| Formula | C157H260N57F3O42 |
| Relative Density. | no data available |
| Sequence | H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Ser-Pro-Ala-Lys-Leu-Ser-Phe-Gln-Phe-Pro-Ser-Ser-Gly-Ser-Ala-Gln-Val-His-Ile-OH |
| Sequence Short | GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Calculator
In Vivo Formulation Calculator (Clear solution)
Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, and a total of 10 animals are to be administered, using a formulation of 
10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.Stock Solution Preparation:
Dissolve 2 mg of the compound in 100 μL DMSO to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
Preparation of the In Vivo Formulation:
1) Add 100 μL of the DMSO stock solution to 400 μL PEG300 and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O and mix thoroughly until a homogeneous solution is obtained.
This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
Dose Conversion
You can also refer to dose conversion for different animals. More Dose Conversion
Tech Support
Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc
Keywords
Preview
Related Tags: buy TAT-DEF-Elk-1 TFA (1220751-16-5 free base) | purchase TAT-DEF-Elk-1 TFA (1220751-16-5 free base) | TAT-DEF-Elk-1 TFA (1220751-16-5 free base) cost | order TAT-DEF-Elk-1 TFA (1220751-16-5 free base) | TAT-DEF-Elk-1 TFA (1220751-16-5 free base) in vivo | TAT-DEF-Elk-1 TFA (1220751-16-5 free base) in vitro | TAT-DEF-Elk-1 TFA (1220751-16-5 free base) formula | TAT-DEF-Elk-1 TFA (1220751-16-5 free base) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.