Your shopping cart is currently empty

Tat-beclin 1scrambled is the disordered segment and control of Tat-beclin 1, derived from a region of the autophagy protein beclin 1. Beclin 1 induces autophagy by interacting with HIV-1Nef and the autophagy inhibitory factor GAPR-1 (GLIPR2). Tat-beclin 1 decreases both the accumulation of polyglutamine-expanded protein aggregates and the replication of several pathogens, such as HIV. Additionally, Tat-beclin 1 reduces mortality rates in mice infected with chikungunya or West Nile virus.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 10 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Tat-beclin 1scrambled is the disordered segment and control of Tat-beclin 1, derived from a region of the autophagy protein beclin 1. Beclin 1 induces autophagy by interacting with HIV-1Nef and the autophagy inhibitory factor GAPR-1 (GLIPR2). Tat-beclin 1 decreases both the accumulation of polyglutamine-expanded protein aggregates and the replication of several pathogens, such as HIV. Additionally, Tat-beclin 1 reduces mortality rates in mice infected with chikungunya or West Nile virus. |
| Formula | C164H251N57O45 |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Val-Gly-Asn-Asp-Phe-Phe-Ile-Asn-His-Glu-Thr-Thr-Gly-Phe-Ala-Thr-Glu-Trp |
| Sequence Short | YGRKKRRQRRRGGVGNDFFINHETTGFATEW |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.