Shopping Cart
- Remove All
- Your shopping cart is currently empty
S961 acetate is a selective and high-affinity antagonist of the insulin receptor (IR), demonstrating IC50 values of 0.048 nM for HIR-A, 0.027 nM for HIR-B, and 630 nM for the human insulin-like growth factor I receptor (HIGF-IR) in SPA assays [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | S961 acetate is a selective and high-affinity antagonist of the insulin receptor (IR), demonstrating IC50 values of 0.048 nM for HIR-A, 0.027 nM for HIR-B, and 630 nM for the human insulin-like growth factor I receptor (HIGF-IR) in SPA assays [1]. |
Molecular Weight | 4864.18 |
Formula | C213H301N55O72S2 |
Sequence | Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40) |
Sequence Short | GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY (Disulfide bridge: Cys33-Cys40) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.