Shopping Cart
- Remove All
- Your shopping cart is currently empty
S961 is a high-affinity, selective insulin receptor (IR) antagonist with IC50 values of 0.048 nM for HIR-A, 0.027 nM for HIR-B, and 630 nM for human insulin-like growth factor I receptor (HIGF-IR) in scintillation proximity assays.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $529 | 4-6 weeks | |
5 mg | $1,590 | 4-6 weeks | |
10 mg | $2,150 | 4-6 weeks | |
25 mg | $3,180 | 4-6 weeks | |
50 mg | $4,320 | 4-6 weeks | |
100 mg | $5,830 | 4-6 weeks |
Description | S961 is a high-affinity, selective insulin receptor (IR) antagonist with IC50 values of 0.048 nM for HIR-A, 0.027 nM for HIR-B, and 630 nM for human insulin-like growth factor I receptor (HIGF-IR) in scintillation proximity assays. |
Molecular Weight | 4804.13 |
Formula | C211H297N55O71S2 |
Cas No. | 1083433-49-1 |
Relative Density. | no data available |
Sequence | Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40) |
Sequence Short | GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY (Disulfide bridge: Cys33-Cys40) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.